Details
Description: Mouse monoclonal antibody against the long isoform of human Collapsin Response Mediator Protein 4 (LCRMP4).
Purification: Protein G affinity purified
Product Type: Primary antibody, can be used as a capture antibody and also a detection antibody in immunoassay.
Target Protein: Human LCRMP4
Immunogen: The N-terminal 127 amino acids of LCRMP4. Below is the amino acid sequence: masgrrgwdssheddlpvylarpgttdqvprqkyggmfcnvegafesktldfdalsvgqrgaktprsgqgsdrgsgsrpgiegdtprrgqgreesrepapaspapagveirsatgkevlqnlgpkdk.
Fusion Myeloma: Sp2/0-Ag14
Specificity: LCRMP4 .
Species Reactivity: Human, others not tested.
Host / Isotype: Mouse, IgG1 Kappa
Formulation: Lyophilized in a 0.01M pH7.2 phosphate buffer solution
Reconstitution: Double distilled water is recommended to adjust the final concentration to 1.00 mg/mL.
Storage: Store at -20oC
Research Area: Neurology. Prostate cancer.
Background:
CRMP4 belongs to the collapsin response mediator protein (CRMP) family that includes CRMP 1-5. CRMPs are highly expressed in the nervous system during brain development. It is also found that CRMP4 is inversely associated with lymph node metastasis of prostate cancers and that the methylation of the CpG island within the promoter region of CRMP4 gene down- regulates CRMP4 expression (Xin Gao et al. 2010; Ke Li et al. 2015). Recently, Dr. Xin Gao’s lab found that a long-form CRMP4 (LCRMP4) is potentially useful as a serum biomarker for prostate cancers.
Application:
1. ELISA & Chemiluminescence Assay
In combination with capture antibody clone 2H7, biotin conjugated clone 7E1 can be used for quantitative detection of LCRMP4 in sandwich ELISA and chemiluminescence assay. The assay range is around 625pg/mL to 10pg/mL.
References:
Xin Gao et al. Expression profiling identifies new function of collapsin response mediator protein 4 as a metastasis-suppressor in prostate cancer. Oncogene. 2010, 29, 4555–4566.
Ke Li et al. Manipulation of prostate cancer metastasis by locus-specific modification of the CRMP4 promoter region using chimeric TALE DNA methyltransferase and demethylase. Oncotarget. 2015, 6(12), 10030-10044.
If research is published using this product, please inform Anogen in order to cite the reference on this datasheet. Anogen will provide one unit of product in the same category as gratitude.



